PDB entry 3g9v

View 3g9v on RCSB PDB site
Description: Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22
Class: cytokine/cytokine receptor
Keywords: CYTOKINE, CYTOKINE RECEPTOR, Receptor, Glycoprotein, Polymorphism, Secreted, CYTOKINE/CYTOKINE RECEPTOR COMPLEX
Deposited on 2009-02-14, released 2009-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-14, with a file datestamp of 2009-04-10.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interleukin 22 receptor, alpha 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22RA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Interleukin-22
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g9vb_
  • Chain 'C':
    Compound: Interleukin 22 receptor, alpha 2
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22RA2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Interleukin-22
    Species: Homo sapiens [TaxId:9606]
    Gene: IL22
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g9vd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g9vB (B:)
    qggaaapisshcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmser
    cylmkqvlnftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqkl
    kdtvkklgesgeikaigeldllfmslrnaci
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9vB (B:)
    hcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnf
    tleevlfpqsdrfqpymqevvpflarlsnrlstchhiqrnvqklkdtvkklgesgeikai
    geldllfmslrnac
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g9vD (D:)
    qggaaapisshcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmser
    cylmkqvlnftleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqkl
    kdtvkklgesgeikaigeldllfmslrnaci
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9vD (D:)
    rldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnftl
    eevlfpqsdrfqpymqevvpflarlsnrlshiqrnvqklkdtvkklgesgeikaigeldl
    lfmslrnaci