PDB entry 3g9o

View 3g9o on RCSB PDB site
Description: GR DNA-binding domain:Sgk 16bp complex-9
Class: transcription/DNA
Keywords: glucocorticoid, DNA-binding, allostery, lever arm, transcription, hormone, Alternative initiation, Chromatin regulator, Cytoplasm, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Receptor, Steroid-binding, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger, TRANSCRIPTION/DNA COMPLEX
Deposited on 2009-02-13, released 2009-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.178
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d3g9oa1, d3g9oa2
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: NR3C1, GRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d3g9ob1, d3g9ob2
  • Chain 'C':
    Compound: DNA (5'-d(*tp*cp*gp*gp*ap*cp*ap*ap*ap*ap*tp*gp*tp*tp*cp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*gp*ap*ap*cp*ap*tp*tp*tp*tp*gp*tp*cp*cp*g)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9oA (A:)
    gshmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqatag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9oA (A:)
    shmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacr
    yrkclqagmnleark
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g9oB (B:)
    gshmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
    ryrkclqagmnlearktkkkikgiqqatag
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9oB (B:)
    shmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacr
    yrkclqagmnleark
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.