PDB entry 3g9e

View 3g9e on RCSB PDB site
Description: Aleglitaar. a new. potent, and balanced dual ppara/g agonist for the treatment of type II diabetes
Class: transcription/transferase
Keywords: NUCLEAR RECEPTOR, TRANSCRIPTION FACTOR, DIABETES, Activator, Alternative splicing, Diabetes mellitus, Disease mutation, DNA-binding, Metal-binding, Nucleus, Obesity, Phosphoprotein, Polymorphism, Receptor, Transcription, Transcription regulation, Zinc, Zinc-finger, Acyltransferase, Chromosomal rearrangement, Proto-oncogene, Transferase, Ubl conjugation, TRANSCRIPTION/TRANSFERASE COMPLEX
Deposited on 2009-02-13, released 2009-06-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g9ea_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: RO7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9eA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
    itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
    ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
    fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
    tehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9eA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkkevai
    rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
    lisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
    llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkt
    etdmslhpllqeiykdly
    

  • Chain 'B':
    No sequence available.