PDB entry 3g9d

View 3g9d on RCSB PDB site
Description: Crystal structure glycohydrolase
Class: hydrolase
Keywords: nitrogenase, DraG, ADP-ribosylation, posttranslational modification, Hydrolase
Deposited on 2009-02-13, released 2009-07-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dinitrogenase reductase activacting glicohydrolase
    Species: Azospirillum brasilense [TaxId:192]
    Gene: draG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3g9da_
  • Chain 'B':
    Compound: Dinitrogenase reductase activacting glicohydrolase
    Species: Azospirillum brasilense [TaxId:192]
    Gene: draG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3g9db_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g9dA (A:)
    mtdhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtd
    dtemsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepes
    eyhagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlg
    gdvrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnq
    ggdadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9dA (A:)
    sirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddtem
    sihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepeseyha
    gngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggdvr
    dvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqggda
    dttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g9dB (B:)
    mtdhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtd
    dtemsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepes
    eyhagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlg
    gdvrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnq
    ggdadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g9dB (B:)
    hsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddte
    msihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepseyha
    gngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggdvr
    dvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqggda
    dttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapal