PDB entry 3g98

View 3g98 on RCSB PDB site
Description: Crystal Structure of the C-Ala domain from Aquifex aeolicus alanyl-tRNA synthetase
Deposited on 2009-02-13, released 2009-10-06
The last revision was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.186
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: alaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (1-110)
      • initiating methionine (0)
  • Chain 'B':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: alaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (1-110)
      • initiating methionine (0)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3g98A (A:)
mkeenvgdftlhygvfeevepeelrnladmlrqrtkkdvvfiasrkgdkinfvigvskei
sdkvnakevirevgkvlkgggggradlaqgggkapdkfpeavkllkeilsg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3g98B (B:)
mkeenvgdftlhygvfeevepeelrnladmlrqrtkkdvvfiasrkgdkinfvigvskei
sdkvnakevirevgkvlkgggggradlaqgggkapdkfpeavkllkeilsg