PDB entry 3g8x

View 3g8x on RCSB PDB site
Description: GR DNA binding domain:GilZ 16bp complex-65
Class: transcription/DNA
Keywords: glucocorticoid, DNA-binding, allostery, lever arm, transcription, hormone, Alternative initiation, Chromatin regulator, Cytoplasm, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Receptor, Steroid-binding, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger, TRANSCRIPTION-DNA COMPLEX
Deposited on 2009-02-12, released 2009-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Glucocorticoid receptor
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Grl, Nr3c1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06536 (4-End)
    • expression tag (2-3)
  Domains in SCOPe 2.08: d3g8xa1, d3g8xa2
• Chain 'B':
  Compound: Glucocorticoid receptor
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Grl, Nr3c1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06536 (4-End)
    • expression tag (3)
  Domains in SCOPe 2.08: d3g8xb1, d3g8xb2
• Chain 'C':
  Compound: DNA (5'-d(*ap*ap*gp*ap*ap*cp*ap*tp*tp*gp*gp*gp*tp*tp*cp*c)-3')
  Species: synthetic, synthetic
  
• Chain 'D':
  Compound: DNA (5'-d(*tp*gp*gp*ap*ap*cp*cp*cp*ap*ap*tp*gp*tp*tp*cp*t)-3')
  Species: synthetic, synthetic
  
• Heterogens: ZN, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3g8xA (A:)
  gshmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
  ryrkclqagmnlearktkkkikgiqqatag
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3g8xA (A:)
  hmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacry
  rkclqagmnlearktk
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3g8xB (B:)
  gshmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
  ryrkclqagmnlearktkkkikgiqqatag
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3g8xB (B:)
  mclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
  kclqagmnlearktk
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.