PDB entry 3g8u

View 3g8u on RCSB PDB site
Description: DNA binding domain:GilZ 16bp complex-5
Class: transcription/DNA
Keywords: glucocorticoid, DNA-binding, allostery, lever arm, transcription, hormone, Alternative initiation, Chromatin regulator, Cytoplasm, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Receptor, Steroid-binding, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger, TRANSCRIPTION-DNA COMPLEX
Deposited on 2009-02-12, released 2009-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grl, Nr3c1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d3g8ua1, d3g8ua2
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grl, Nr3c1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.08: d3g8ub1, d3g8ub2
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*gp*ap*ap*cp*ap*tp*tp*gp*gp*gp*tp*tp*cp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*gp*ap*ap*cp*cp*cp*ap*ap*tp*gp*tp*tp*cp*t)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3g8uA (A:)
gshmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
ryrkclqagmnlearktkkkikgiqqatag

    Sequence, based on observed residues (ATOM records): (download) 
    >3g8uA (A:)
shmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacr
yrkclqagmnlearktkkk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3g8uB (B:)
gshmclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpac
ryrkclqagmnlearktkkkikgiqqatag

    Sequence, based on observed residues (ATOM records): (download) 
    >3g8uB (B:)
mclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncpacryr
kclqagmnlear

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.