PDB entry 3g8s

View 3g8s on RCSB PDB site
Description: crystal structure of the pre-cleaved bacillus anthracis glms ribozyme
Deposited on 2009-02-12, released 2009-11-03
The last revision was dated 2021-10-20, with a file datestamp of 2021-10-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-97)
      • engineered mutation (30)
      • engineered mutation (35)
  • Chain 'B':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-97)
      • engineered mutation (30)
      • engineered mutation (35)
  • Chain 'C':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-97)
      • engineered mutation (30)
      • engineered mutation (35)
  • Chain 'D':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (0-97)
      • engineered mutation (30)
      • engineered mutation (35)
  • Chain 'E':
    Compound: RNA (5'-r(*ap*(a2m)p*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: RNA (5'-r(*ap*(a2m)p*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: RNA (5'-r(*ap*(a2m)p*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: RNA (5'-r(*ap*(a2m)p*gp*cp*gp*cp*cp*ap*gp*ap*ap*cp*u)-3')
    Species: synthetic, synthetic
  • Chain 'P':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'Q':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'R':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Chain 'S':
    Compound: glms ribozyme
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3g8sA (A:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records):
    >3g8sA (A:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3g8sB (B:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records):
    >3g8sB (B:)
etrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevss
atnalrsmqgfpfydkpmriqyaktdsdiiakmk

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3g8sC (C:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records):
    >3g8sC (C:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3g8sD (D:)
mavpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifk
evssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records):
    >3g8sD (D:)
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.