PDB entry 3g7z

View 3g7z on RCSB PDB site
Description: CcdB dimer in complex with two C-terminal CcdA domains
Class: toxin/toxin repressor
Keywords: ALPHA+BETA, SH3 domain, intrinsically disordered, TOXIN/TOXIN REPRESSOR COMPLEX
Deposited on 2009-02-11, released 2009-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-11, with a file datestamp of 2009-08-07.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytotoxic protein ccdB
  Species: Escherichia coli [TaxId:562]
  Gene: ccdB, ECOK12F043, G, letB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62554 (0-100)
  Domains in SCOPe 2.08: d3g7za_
• Chain 'B':
  Compound: Cytotoxic protein ccdB
  Species: Escherichia coli [TaxId:562]
  Gene: ccdB, ECOK12F043, G, letB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62554 (0-100)
  Domains in SCOPe 2.08: d3g7zb_
• Chain 'C':
  Compound: Protein ccdA
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62552 (Start-35)
• Chain 'D':
  Compound: Protein ccdA
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62552 (Start-35)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3g7zA (A:)
  mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
  wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3g7zB (B:)
  mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
  wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.