PDB entry 3g7p

View 3g7p on RCSB PDB site
Description: crystal structure of a nifx-associated protein of unknown function (afe_1514) from acidithiobacillus ferrooxidans atcc at 2.00 a resolution
Deposited on 2009-02-10, released 2009-03-03
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrogen fixation protein
    Species: Acidithiobacillus ferrooxidans ATCC 23270 [TaxId:243159]
    Gene: Lferr_1232, YP_002425942.1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, PG6, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3g7pA (A:)
gmpentamaallpeeslffrelvkqwraqdsygtwekksdmellapyvldkeqrraipii
gdpdpeilwrvelfynavglaterasgvmvspmmkmshegfgrmvliagrlivvnkqlrd
vhrfgfpsmeklaeegdklvagalemiekfpevarf

    Sequence, based on observed residues (ATOM records):
    >3g7pA (A:)
lpeeslffrelvkqwraqdsygtwekksdmellapyvldkeqrraipiigdpdpeilwrv
elfynavglaterasgvmvspmmkmshegfgrmvliagrlivvnkqlrdvhrfgfpsmek
laeegdklvagalemiekfpevarf