PDB entry 3g7i

View 3g7i on RCSB PDB site
Description: Crystal structure of a Delta class GST (adGSTD4-4) from Anopheles dirus, with glutathione complexed in one subunit
Class: transferase
Keywords: ENZYME-SUBSTRATE COMPLEX, Transferase
Deposited on 2009-02-10, released 2010-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase GST1-4
    Species: Anopheles dirus [TaxId:7168]
    Gene: GSTD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g7ia1, d3g7ia2
  • Chain 'B':
    Compound: glutathione transferase GST1-4
    Species: Anopheles dirus [TaxId:7168]
    Gene: GSTD4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g7ib1, d3g7ib2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g7iA (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryftqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g7iA (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagenpqhciptlvdedgfvlwesrai
    qiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpv
    gdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagydlrryenvq
    rwyertsaivpgadknvegakvfgryft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g7iB (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryftqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g7iB (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    dpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagydlrryenvqr
    wyertsaivpgadknvegakvfg