PDB entry 3g6t

View 3g6t on RCSB PDB site
Description: GR gamma DNA-binding domain:FKBP5 16bp complex-34
Class: transcription/DNA
Keywords: glucocorticoid, DNA-binding, allostery, lever arm, transcription, hormone, Alternative initiation, Chromatin regulator, Cytoplasm, Lipid-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Receptor, Steroid-binding, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger, TRANSCRIPTION-DNA COMPLEX
Deposited on 2009-02-08, released 2009-04-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grl, Nr3c1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (4-End)
      • expression tag (1-3)
      • insertion (35)
    Domains in SCOPe 2.08: d3g6ta1, d3g6ta2
  • Chain 'B':
    Compound: Glucocorticoid receptor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grl, Nr3c1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (4-End)
      • expression tag (2-3)
      • insertion (35)
    Domains in SCOPe 2.08: d3g6tb1, d3g6tb2
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*gp*ap*ap*cp*ap*gp*gp*gp*tp*gp*tp*tp*cp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*gp*ap*ap*cp*ap*cp*cp*cp*tp*gp*tp*tp*cp*t)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3g6tA (A:)
gshmclvcsdeasgchygvltcgsckvffkravegrqhnylcagrndciidkirrkncpa
cryrkclqagmnlearktkkkikgiqqatag

    Sequence, based on observed residues (ATOM records): (download) 
    >3g6tA (A:)
shmclvcsdeasgchygvltcgsckvffkravegrqhnylcagrndciidkirrkncpac
ryrkclqagmnlearktk

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3g6tB (B:)
gshmclvcsdeasgchygvltcgsckvffkravegrqhnylcagrndciidkirrkncpa
cryrkclqagmnlearktkkkikgiqqatag

    Sequence, based on observed residues (ATOM records): (download) 
    >3g6tB (B:)
hmclvcsdeasgchygvltcgsckvffkravegrqhnylcagrndciidkirrkncpacr
yrkclqagmnle

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.