PDB entry 3g6a

View 3g6a on RCSB PDB site
Description: Crystal structure of anti-IL-13 antibody CNTO607
Class: immune system
Keywords: IL-13, antibody, Fab, MONOCLONAL ANTIBODY, IMMUNE SYSTEM
Deposited on 2009-02-06, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CNTO607 Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G6A (0-End)
    Domains in SCOPe 2.07: d3g6aa1, d3g6aa2
  • Chain 'B':
    Compound: CNTO607 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G6A (0-End)
    Domains in SCOPe 2.07: d3g6ab1, d3g6ab2
  • Chain 'H':
    Compound: CNTO607 Fab Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G6A (0-End)
    Domains in SCOPe 2.07: d3g6ah1, d3g6ah2
  • Chain 'L':
    Compound: CNTO607 Fab Light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3G6A (0-End)
    Domains in SCOPe 2.07: d3g6al1, d3g6al2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g6aA (A:)
    syeltqppsvsvapgqtariscsgdniggtfvswyqqkpgqapvlviyddndrpsgiper
    fsgsnsgntatltisgtqaedeadyycgtwdmvtnnvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6aA (A:)
    syeltqppsvsvapgqtariscsgdniggtfvswyqqkpgqapvlviyddndrpsgiper
    fsgsnsgntatltisgtqaedeadyycgtwdmvtnnvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g6aB (B:)
    qvqlvesggglvqpggslrlscaasgftfnsywinwvrqapgkglewvsgiaydssntly
    adsvkgrftisrdnskntlylqmnslraedtavyycarglgafhwdmqpdywgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6aB (B:)
    qvqlvesggglvqpggslrlscaasgftfnsywinwvrqapgkglewvsgiaydssntly
    adsvkgrftisrdnskntlylqmnslraedtavyycarglgafhwdmqpdywgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3g6aH (H:)
    qvqlvesggglvqpggslrlscaasgftfnsywinwvrqapgkglewvsgiaydssntly
    adsvkgrftisrdnskntlylqmnslraedtavyycarglgafhwdmqpdywgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkth
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6aH (H:)
    qvqlvesggglvqpggslrlscaasgftfnsywinwvrqapgkglewvsgiaydssntly
    adsvkgrftisrdnskntlylqmnslraedtavyycarglgafhwdmqpdywgqgtlvtv
    ssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlq
    ssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3g6aL (L:)
    syeltqppsvsvapgqtariscsgdniggtfvswyqqkpgqapvlviyddndrpsgiper
    fsgsnsgntatltisgtqaedeadyycgtwdmvtnnvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g6aL (L:)
    syeltqppsvsvapgqtariscsgdniggtfvswyqqkpgqapvlviyddndrpsgiper
    fsgsnsgntatltisgtqaedeadyycgtwdmvtnnvfgggtkltvlgqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvapt