PDB entry 3g5z

View 3g5z on RCSB PDB site
Description: Antibodies Specifically Targeting a Locally Misfolded Region of Tumor Associated EGFR
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2009-02-05, released 2010-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 175 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3G5Z (0-212)
    Domains in SCOPe 2.07: d3g5za1, d3g5za2
  • Chain 'B':
    Compound: 175 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3G5Z (0-216)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3g5zA (A:)
dilmtqspssmsvslgdtvsitchasqdiisnigwlqqkpgksfagliyhgtnlsdgvps
rfsgsgsgadysltisslesedfadyycvqyaqfpwtfgggtkleiaradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrne

  • Chain 'B':
    No sequence available.