PDB entry 3g5f

View 3g5f on RCSB PDB site
Description: Crystallographic analysis of cytochrome P450 cyp121
Class: oxidoreductase
Keywords: cytochrome, tuberculosis, cyp121, P450, Heme, Iron, Metal-binding, Monooxygenase, Oxidoreductase
Deposited on 2009-02-05, released 2009-04-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 121
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g5fa_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g5fA (A:)
    mtatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrf
    smketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansl
    ldnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaaki
    nwdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgs
    flttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvr
    kgelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigie
    allkkmpgvdlavpidqlvwrtrfqrriperlpvlw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g5fA (A:)
    atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
    ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
    nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
    drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
    ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
    elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
    lkkmpgvdlavpidqlvwrtrfqrriperlpvlw