PDB entry 3g58

View 3g58 on RCSB PDB site
Description: Crystal structure of human phosphodiesterase 4d with d155988/pmnpq
Class: hydrolase
Keywords: phosphodiesterase, PDE4D, Alternative splicing, cAMP, Cytoplasm, Cytoskeleton, Hydrolase, Membrane, Metal-binding, Phosphoprotein
Deposited on 2009-02-04, released 2010-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.173
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g58a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g58b_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g58c_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g58d_
  • Heterogens: ZN, MG, SO4, 988, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g58A (A:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapapapddpeegrqgqtekfqfel
    tleedgesdtekdsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g58A (A:)
    siprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfki
    pvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifas
    aihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqr
    qslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhca
    dlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyiv
    hplwetwadlvhpdaqdildtlednrewyqstipq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g58B (B:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapapapddpeegrqgqtekfqfel
    tleedgesdtekdsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g58B (B:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g58C (C:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapapapddpeegrqgqtekfqfel
    tleedgesdtekdsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g58C (C:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g58D (D:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqapapapddpeegrqgqtekfqfel
    tleedgesdtekdsghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g58D (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqgqtekfqfelt