PDB entry 3g4x

View 3g4x on RCSB PDB site
Description: Crystal Structure of NiSOD Y9F mutant
Class: oxidoreductase
Keywords: Nickel, Hexamer, Superoxide dismutase, NiSOD, SOD, Antioxidant, Metal-binding, Oxidoreductase
Deposited on 2009-02-04, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: 2SC7G11.16c, SCO5254, sod1, sodN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (8)
    Domains in SCOPe 2.08: d3g4xa_
  • Chain 'B':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: 2SC7G11.16c, SCO5254, sod1, sodN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-116)
      • engineered (8)
    Domains in SCOPe 2.08: d3g4xb_
  • Chain 'C':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces coelicolor [TaxId:1902]
    Gene: 2SC7G11.16c, SCO5254, sod1, sodN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80735 (0-End)
      • engineered (8)
    Domains in SCOPe 2.08: d3g4xc_
  • Heterogens: NI, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g4xA (A:)
    hcdlpcgvfdpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g4xB (B:)
    hcdlpcgvfdpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g4xC (C:)
    hcdlpcgvfdpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g4xC (C:)
    hcdlpcgvfdpaqarieaesvkavqekmagnddphfqtratvikeqraelakhhvsvlws
    dyfkpphfekypelhqlvndtlkalsaakgskdpatgqkaldyiaqidkifwetkk