PDB entry 3g49

View 3g49 on RCSB PDB site
Description: N-(Pyridin-2-yl) Arylsulfonamide Inhibitors of 11b-Hydroxysteroid Dehydrogenase Type 1: Discovery of PF-915275
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: 11beta-hydroxysteroid dehydrogenase, inhibited, Endoplasmic reticulum, Glycoprotein, Lipid metabolism, Membrane, NADP, Oxidoreductase, Signal-anchor, Steroid metabolism, Transmembrane, Oxidoreductase-Oxidoreductase inhibitor COMPLEX
Deposited on 2009-02-03, released 2009-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g49a_
  • Chain 'B':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g49b_
  • Chain 'C':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g49c_
  • Chain 'D':
    Compound: 11-beta-hydroxysteroid dehydrogenase 1
    Species: Cavia porcellus [TaxId:10141]
    Gene: HSD11B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g49d_
  • Heterogens: NAP, 3G4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g49A (A:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeflsaaeynwdnvlsneklygrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g49A (A:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g49B (B:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeflsaaeynwdnvlsneklygrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g49B (B:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g49C (C:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeflsaaeynwdnvlsneklygrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g49C (C:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g49D (D:)
    nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
    asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
    fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
    nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
    vpyllgnpgrkimeflsaaeynwdnvlsneklygrwa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g49D (D:)
    kfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelgaas
    ahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevnfh
    sfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflvnk
    vnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrwvp
    yllgnpgrkimeflsaaeynwdn