PDB entry 3g3p

View 3g3p on RCSB PDB site
Description: The structure of the M53A Mutant of the Caulobacter crescentus CLPS in complex with a peptide containing an amino-terminal norleucine residue
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, PEPTIDE BINDING PROTEIN
Deposited on 2009-02-02, released 2010-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A5I0 (Start-84)
      • engineered (18)
    Domains in SCOPe 2.08: d3g3pa_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A5I0 (Start-84)
      • engineered (18)
    Domains in SCOPe 2.08: d3g3pb_
  • Chain 'D':
    Compound: Peptide (NLE)LFVQRDSKE
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3G3P (0-End)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3g3pA (A:)
tqkpslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3g3pA (A:)
pslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk
vaqvidsarrhqhplqctmekd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3g3pB (B:)
tqkpslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3g3pB (B:)
pslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetk
vaqvidsarrhqhplqctmekd

  • Chain 'D':
    No sequence available.