PDB entry 3g3n

View 3g3n on RCSB PDB site
Description: PDE7A catalytic domain in complex with 3-(2,6-difluorophenyl)-2-(methylthio)quinazolin-4(3H)-one
Class: hydrolase
Keywords: pde7, crystal, inhibitor complex, Alternative splicing, cAMP, Hydrolase, Phosphoprotein
Deposited on 2009-02-02, released 2009-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE7A, PDE7A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g3na_
  • Heterogens: TC8, ZN, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g3nA (A:)
    dyngqakcmlekvgnwnfdiflfdrltngnslvsltfhlfslhglieyfhldmmklrrfl
    vmiqedyhsqnpyhnavhaadvtqamhcylkepklansvtpwdillsliaaathdldhpg
    vnqpfliktnhylatlykntsvlenhhwrsavgllresglfshlplesrqqmetqigali
    latdisrqneylslfrshldrgdlcledtrhrhlvlqmalkcadicnpcrtwelskqwse
    kvteeffhqgdiekkyhlgvsplcdrhtesianiqigfmtylveplftewarfsntrlsq
    tmlghvglnkaswkglqr