PDB entry 3g39

View 3g39 on RCSB PDB site
Description: Structure of a lamprey variable lymphocyte receptor
Class: immune system
Keywords: VLR, antibody, x-ray, crystallography, IMMUNE SYSTEM
Deposited on 2009-02-02, released 2009-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.165
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: variable lymphocyte receptor VLRB.2D
    Species: Petromyzon marinus [TaxId:7757]
    Gene: VLR
    Database cross-references and differences (RAF-indexed):
    • PDB 3G39
    Domains in SCOPe 2.07: d3g39a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g39A (A:)
    macpsqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrld
    ldnnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsd
    ilylsrwisqhpglvfgylnldpdsarcsgtntpvravteastspskcpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g39A (A:)
    acpqcscsgttvdcsgkslasvptgiptttqvlylydnqitklepgvfdrltqltrldld
    nnqltvlpagvfdkltqltqlslndnqlksiprgafdnlkslthiwllnnpwdcacsdil
    ylsrwisqhpglvfgylnldpdsarcsgntpvravteastspskc