PDB entry 3g33

View 3g33 on RCSB PDB site
Description: Crystal structure of CDK4/cyclin D3
Class: cell cycle
Keywords: Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-binding, Cell division, Disease mutation, Kinase, Nucleotide-binding, Phosphoprotein, Proto-oncogene, Serine/threonine-protein kinase, Transferase, Cyclin
Deposited on 2009-02-01, released 2009-03-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.283
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3g33a_
  • Chain 'B':
    Compound: CCND3 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CCND3, hCG_16683
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: cell division protein kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3g33c_
  • Chain 'D':
    Compound: CCND3 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CCND3, hCG_16683
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g33A (A:)
    gplgsmatsryepvaeigvgaygtvykardphsghfvalksvrvpnggggggglpistvr
    evallrrleafehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpae
    tikdlmrqflrgldflhancivhrdlkpenilvtsggtvkladfglariysyqmaltpvv
    vtlwyrapevllqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppe
    ddwprdvslprgafpprgprpvqsvvpemeesgaqlllemltfnphkrisafralqhsyl
    hkdegnpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g33A (A:)
    ryepvaeigvgaygtvykardphsghfvalksvrvpnggggggglpistvrevallrrle
    afehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpaetikdlmrqf
    lrgldflhancivhrdlkpenilvtsggtvkladfglariysyqmaltpvvvtlwyrape
    vllqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppeddwprdvsl
    prgafpprgprpvqsvvpemeesgaqlllemltfnphkrisafralqhsyl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g33C (C:)
    gplgsmatsryepvaeigvgaygtvykardphsghfvalksvrvpnggggggglpistvr
    evallrrleafehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpae
    tikdlmrqflrgldflhancivhrdlkpenilvtsggtvkladfglariysyqmaltpvv
    vtlwyrapevllqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppe
    ddwprdvslprgafpprgprpvqsvvpemeesgaqlllemltfnphkrisafralqhsyl
    hkdegnpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g33C (C:)
    ryepvaeigvgaygtvykardphsghfvalksvrvpnggggggglpistvrevallrrle
    afehpnvvrlmdvcatsrtdreikvtlvfehvdqdlrtyldkapppglpaetikdlmrqf
    lrgldflhancivhrdlkpenilvtsggtvkladfglariysyqmaltpvvvtlwyrape
    vllqstyatpvdmwsvgcifaemfrrkplfcgnseadqlgkifdliglppeddwprdvsl
    prgafpprgprpvqsvvpemeesgaqlllemltfnphkrisafralqhsyl
    

  • Chain 'D':
    No sequence available.