PDB entry 3g2b

View 3g2b on RCSB PDB site
Description: crystal structure of PqqD from xanthomonas campestris
Deposited on 2009-01-31, released 2009-09-01
The last revision was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.196
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coenzyme PQQ synthesis protein D
    Species: Xanthomonas campestris pv. campestris [TaxId:340]
    Gene: pqqD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3g2bA (A:)
snamstisrdscpalragvrlqhdrardqwvllapervvelddialvvaqrydgtqslaq
iaqtlaaefdadaseietdvieltttlhqkrllrl

    Sequence, based on observed residues (ATOM records):
    >3g2bA (A:)
tisrdscpalragvrlqhdrardqwvllapervvelddialvvaqrydgtqslaqiaqtl
aaefdadaseietdvieltttlhqkrllrl