PDB entry 3g25

View 3g25 on RCSB PDB site
Description: 1.9 Angstrom Crystal Structure of Glycerol Kinase (glpK) from Staphylococcus aureus in Complex with Glycerol.
Class: transferase
Keywords: Glycerol kinase, Glycerol, idp00743, ATP-binding, Glycerol metabolism, Kinase, Nucleotide-binding, Transferase, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2009-01-30, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycerol kinase
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: glpK, SACOL1320
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HGD2 (3-500)
      • expression tag (2)
    Domains in SCOPe 2.07: d3g25a1, d3g25a2, d3g25a3
  • Chain 'B':
    Compound: glycerol kinase
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: glpK, SACOL1320
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HGD2 (3-500)
      • expression tag (2)
    Domains in SCOPe 2.07: d3g25b1, d3g25b2, d3g25b3
  • Chain 'C':
    Compound: glycerol kinase
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: glpK, SACOL1320
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g25c1, d3g25c2
  • Chain 'D':
    Compound: glycerol kinase
    Species: Staphylococcus aureus subsp. aureus COL [TaxId:93062]
    Gene: glpK, SACOL1320
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5HGD2 (3-500)
      • expression tag (2)
    Domains in SCOPe 2.07: d3g25d1, d3g25d2, d3g25d3
  • Heterogens: GOL, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g25A (A:)
    snamekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvla
    vmtevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqq
    gyeqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaa
    hitdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevp
    iagvagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkv
    nyalegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywds
    eargaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfi
    mqfqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdege
    reklyrgwkkaveatqvfkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g25A (A:)
    amekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavm
    tevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgy
    eqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahi
    tdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpia
    gvagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkvny
    alegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywdsea
    rgaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfimq
    fqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegere
    klyrgwkkaveatqvfkte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g25B (B:)
    snamekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvla
    vmtevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqq
    gyeqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaa
    hitdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevp
    iagvagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkv
    nyalegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywds
    eargaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfi
    mqfqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdege
    reklyrgwkkaveatqvfkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g25B (B:)
    amekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavm
    tevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgy
    eqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahi
    tdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpia
    gvagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkvny
    alegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywdsea
    rgaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfimq
    fqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegere
    klyrgwkkaveatqvfkte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g25C (C:)
    snamekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvla
    vmtevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqq
    gyeqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaa
    hitdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevp
    iagvagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkv
    nyalegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywds
    eargaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfi
    mqfqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdege
    reklyrgwkkaveatqvfkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g25C (C:)
    mekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavmt
    evinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgye
    qtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahit
    dysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpiag
    vagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkvnya
    legsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywdsear
    gaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfimqf
    qadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegerek
    lyrgwkkaveatqvfkte
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g25D (D:)
    snamekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvla
    vmtevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqq
    gyeqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaa
    hitdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevp
    iagvagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkv
    nyalegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywds
    eargaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfi
    mqfqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdege
    reklyrgwkkaveatqvfkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g25D (D:)
    amekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavm
    tevinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgy
    eqtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahi
    tdysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpia
    gvagdqqaalfgqacfergdvkntygtggfmlmntgdkavksesgllttiaygidgkvny
    alegsifvsgsaiqwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywdsea
    rgaifgltrgtekehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfimq
    fqadivntsverpeiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegere
    klyrgwkkaveatqvfkte