PDB entry 3g20

View 3g20 on RCSB PDB site
Description: Crystal structure of the major pseudopilin from the type 2 secretion system of enterohaemorrhagic Escherichia coli
Class: protein transport
Keywords: general secretory pathway, major pilin, protein transport, complex
Deposited on 2009-01-30, released 2009-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II secretion protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECO57PM05, etpG, GSPG, L7036
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g20a_
  • Chain 'B':
    Compound: Type II secretion protein
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: ECO57PM05, etpG, GSPG, L7036
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g20b_
  • Heterogens: NHE, CA, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g20A (A:)
    gamaslvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptv
    qpeprnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtlgn
    aqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g20A (A:)
    slvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptvqpep
    rnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g20B (B:)
    gamaslvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptv
    qpeprnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtlgn
    aqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g20B (B:)
    slvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptvqpep
    rnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtlgnaqp