PDB entry 3g1q

View 3g1q on RCSB PDB site
Description: Crystal structure of sterol 14-alpha demethylase (CYP51) from Trypanosoma brucei in ligand free state
Class: oxidoreductase
Keywords: sterol 14-alpha demethylase, CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, membrane protein, sterol biosynthesis
Deposited on 2009-01-30, released 2009-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sterol 14-alpha-demethylase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: CYP51, Tb11.02.4080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385E8 (Start-449)
      • engineered (2-4)
    Domains in SCOPe 2.07: d3g1qa_
  • Chain 'B':
    Compound: Sterol 14-alpha-demethylase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: CYP51, Tb11.02.4080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385E8 (Start-449)
      • engineered (2-4)
    Domains in SCOPe 2.07: d3g1qb_
  • Chain 'C':
    Compound: Sterol 14-alpha-demethylase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: CYP51, Tb11.02.4080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385E8 (0-449)
      • engineered (0-4)
    Domains in SCOPe 2.07: d3g1qc_
  • Chain 'D':
    Compound: Sterol 14-alpha-demethylase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: CYP51, Tb11.02.4080
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q385E8 (Start-449)
      • engineered (2-4)
    Domains in SCOPe 2.07: d3g1qd_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g1qA (A:)
    skgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdpheh
    srfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpai
    qhevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmes
    slipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgll
    savyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieef
    paqlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspll
    shhdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfq
    llrdevpdpdyhtmvvgptasqcrvkyirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g1qA (A:)
    gklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsr
    fflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
    evrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessl
    ipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgllsa
    vyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpa
    qlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllsh
    hdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqll
    rdevpdpdyhtmvvgptasqcrvkyirr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g1qB (B:)
    skgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdpheh
    srfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpai
    qhevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmes
    slipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgll
    savyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieef
    paqlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspll
    shhdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfq
    llrdevpdpdyhtmvvgptasqcrvkyirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g1qB (B:)
    gklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsr
    fflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
    evrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessl
    ipaavflpillklplpqsarcheartelqkilseiiiarkeeevstsdllsgllsavyrd
    gtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaqlny
    nnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshhdee
    afpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllrdev
    pdpdyhtmvvgptasqcrvkyirr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3g1qC (C:)
    skgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdpheh
    srfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpai
    qhevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmes
    slipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgll
    savyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieef
    paqlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspll
    shhdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfq
    llrdevpdpdyhtmvvgptasqcrvkyirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g1qC (C:)
    skgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdpheh
    srfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpai
    qhevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmes
    slipaavflpillklplpqsarcheartelqkilseiiiarkeeevnktsdllsgllsav
    yrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaq
    lnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshh
    deeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllr
    devpdpdyhtmvvgptasqcrvkyirr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3g1qD (D:)
    skgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdpheh
    srfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpai
    qhevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmes
    slipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgll
    savyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieef
    paqlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspll
    shhdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfq
    llrdevpdpdyhtmvvgptasqcrvkyirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g1qD (D:)
    gklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsr
    fflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqh
    evrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmessl
    ipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgllsa
    vyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpa
    qlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllsh
    hdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqll
    rdevpdpdyhtmvvgptasqcrvkyirr