SCOPe 2.03: Structural Classification of Proteins

PDB entry 3g1f

View 3g1f on RCSB PDB site
Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with 5,6-dihydroorotidine 5'-monophosphate
Class: lyase
Keywords: orotidine 5'-monophosphate decarboxylase, H2-OMP, crystal structure, Decarboxylase, Pyrimidine biosynthesis, LYASE
Deposited on 2009-01-29, released 2009-06-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fa_
Chain 'B':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fb_
Chain 'C':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fc_
Chain 'D':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fd_
Chain 'E':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fe_
Chain 'F':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1ff_
Chain 'G':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fg_
Chain 'H':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fh_
Chain 'I':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fi_
Chain 'J':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fj_
Chain 'K':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fk_
Chain 'L':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fl_
Chain 'M':
Compound: orotidine 5'-phosphate decarboxylase
Species: Methanothermobacter thermautotrophicus str. Delta H [TaxId:187420]
Gene: pyrF, MTH_129
Database cross-references and differences (RAF-indexed):
- Uniprot O26232
  - engineered (100)
Domains in SCOPe 2.03: d3g1fm_
Heterogens: 2OM, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3g1fA (A:)
mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp