PDB entry 3g1b

View 3g1b on RCSB PDB site
Description: The structure of the M53A mutant of Caulobacter crescentus clpS protease adaptor protein in complex with WLFVQRDSKE peptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, PEPTIDE BINDING PROTEIN
Deposited on 2009-01-29, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A5I0 (Start-84)
      • engineered (18)
    Domains in SCOPe 2.08: d3g1ba_
  • Chain 'B':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9A5I0 (Start-84)
      • engineered (18)
    Domains in SCOPe 2.08: d3g1bb_
  • Chain 'C':
    Compound: 10-residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3G1B (0-End)
  • Chain 'D':
    Compound: 10-residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3G1B (0-End)
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3g1bA (A:)
tqkpslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3g1bA (A:)
lyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetkva
qvidsarrhqhplqctmekd

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3g1bB (B:)
tqkpslyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3g1bB (B:)
slyrvlilnddytpaefvvyvlerffnksredatrimlhvhqngvgvcgvytyevaetkv
aqvidsarrhqhplqctmekd

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.