PDB entry 3g19

View 3g19 on RCSB PDB site
Description: The structure of the Caulobacter crescentus clpS protease adaptor protein in complex with LLL tripeptide
Class: peptide binding protein
Keywords: adaptor, protein-peptide complex, peptide-binding protein, PEPTIDE BINDING PROTEIN
Deposited on 2009-01-29, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease adapter protein clpS
    Species: Caulobacter vibrioides [TaxId:155892]
    Gene: CC_2467, clpS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g19a_
  • Chain 'C':
    Compound: LLL tripeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3G19 (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3g19A (A:)
tqkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyeva
etkvaqvidsarrhqhplqctmekd

    Sequence, based on observed residues (ATOM records): (download) 
    >3g19A (A:)
qkpslyrvlilnddytpmefvvyvlerffnksredatrimlhvhqngvgvcgvytyevae
tkvaqvidsarrhqhplqctmekd

  • Chain 'C':
    No sequence available.