PDB entry 3g0v

View 3g0v on RCSB PDB site
Description: Crystal structure of the C-terminal domain from the Rous Sarcoma Virus capsid protein: mutant D179A
Class: viral protein
Keywords: alpha-helical bundle, capsid protein, virion, viral protein, retrovirus
Deposited on 2009-01-29, released 2009-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gag polyprotein
    Species: Rous sarcoma virus [TaxId:11888]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03322 (Start-76)
      • engineered (29)
    Domains in SCOPe 2.08: d3g0va_
  • Heterogens: NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3g0vA (A:)
agpwadimqgpsesfvdfanrlikavegsalppsarapviidcfrqksqpdiqqlirtap
stlttpgeiikyvldrq

    Sequence, based on observed residues (ATOM records): (download) 
    >3g0vA (A:)
gpwadimqgpsesfvdfanrlikavegsalppsarapviidcfrqksqpdiqqlirtaps
tlttpgeiikyvldrq