PDB entry 3g0q

View 3g0q on RCSB PDB site
Description: Crystal Structure of MutY bound to its inhibitor DNA
Class: hydrolase/DNA
Keywords: Helix-hairpin-helix motif, DNA glycosylase, 8-oxoguanine, protein-DNA complex, Adenine glycosylase, DNA repair, Glycosidase, Hydrolase, HYDROLASE/DNA COMPLEX
Deposited on 2009-01-28, released 2009-11-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.246
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A/G-specific adenine glycosylase
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Gene: mutY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83847 (0-351)
      • engineered (135)
      • engineered (155)
    Domains in SCOPe 2.04: d3g0qa1, d3g0qa2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*gp*ap*cp*(8og)p*gp*gp*gp*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*tp*cp*cp*cp*ap*gp*tp*cp*tp*t)-3'
  • Heterogens: SF4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g0qA (A:)
    parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
    ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
    gavlslaygvpepavdgnvmrvlsrlflvtddiakcstrkrfeqivreimayenpgafne
    alielgalvctprrpscllcpvqaycqafaegvaeelpvkmkktavkqvplavavladde
    grvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglqveltepivsfehafs
    hlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreykewas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0qA (A:)
    parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
    ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
    gavlslaygvpepavdgnvmrvlsrlflvtddiakcstrkrfeqivreimayenpgafne
    alielgalvctprrpscllcpvqaycqafaegvaeelpvkmvkqvplavavladdegrvl
    irkrdstgllanlwefpscetdgadgkekleqmvglqveltepivsfehafshlvwqltv
    fpgrlvhggpveepyrlapedelkayafpvshqrvwreykewas
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.