PDB entry 3g0m

View 3g0m on RCSB PDB site
Description: Crystal structure of cysteine desulfuration protein SufE from Salmonella typhimurium LT2
Class: hydrolase
Keywords: cysteine desulfuration protein SufE, ynhA, CSGID, National Institute of Allergy and Infectious Diseases, NIAID, HYDROLASE, Structural Genomics, Center for Structural Genomics of Infectious Diseases
Deposited on 2009-01-28, released 2009-02-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.188
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfuration protein sufE
    Species: Salmonella typhimurium LT2 [TaxId:99287]
    Gene: gi:16764724, NP_460339, STM1374, sufE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3g0ma_
  • Heterogens: BME, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g0mA (A:)
    snamaalpdkekllrnftrcanweekylyiielgqrlaelnpqdrnpqntihgcqsqvwi
    vmrrnangiielqgdsdaaivkglmavvfilyhqmtaqdivhfdvrpwfekmalaqhltp
    srsqgleamirairakaatls
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0mA (A:)
    maalpdkekllrnftrcanweekylyiielgqrlaelnpqdrnpqntihgcqsqvwivmr
    rnangiielqgdsdaaivkglmavvfilyhqmtaqdivhfdvrpwfekmalaqhltpsrs
    qgleamirairakaatls