PDB entry 3g0l

View 3g0l on RCSB PDB site
Description: Crystal Structure of Human Bromodomain Adjacent to Zinc finger domain 2B (BAZ2B)
Class: transcription
Keywords: BAZB2, bromodomain adjacent to zinc finger domain, 2B, KIAA1476, WALp4, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on 2009-01-28, released 2009-02-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d3g0la_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g0lA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0lA (A:)
    smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
    eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk