PDB entry 3g0i

View 3g0i on RCSB PDB site
Description: Complex of Aspergillus niger epoxide hydrolase with valpromide (2-propylpentanamide)
Class: hydrolase
Keywords: Epoxide hydrolase, alpha/beta hydrolase fold, valpromide, 2-propylpentanamide, Hydrolase
Deposited on 2009-01-28, released 2009-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epoxide hydrolase
    Species: ASPERGILLUS NIGER [TaxId:5061]
    Gene: hyl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UR30 (2-393)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3g0ia1, d3g0ia2
  • Chain 'B':
    Compound: epoxide hydrolase
    Species: ASPERGILLUS NIGER [TaxId:5061]
    Gene: hyl1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UR30 (2-393)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3g0ib1, d3g0ib2
  • Heterogens: VPR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g0iA (A:)
    kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
    tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
    efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
    gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
    kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
    ltesfpraihtyrettptasapngatmlqkelyihkpfgfsffpkdlcpvprswiattgn
    lvffrdhaegghfaalerprelktdltafveqvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0iA (A:)
    kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
    tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
    efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
    gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
    kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
    ltesfpraihtyrettpmlqkelyihkpfgfsffpkdlcpvprswiattgnlvffrdhae
    gghfaalerprelktdltafveqvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g0iB (B:)
    kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
    tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
    efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
    gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
    kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
    ltesfpraihtyrettptasapngatmlqkelyihkpfgfsffpkdlcpvprswiattgn
    lvffrdhaegghfaalerprelktdltafveqvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0iB (B:)
    kafakfpssasispnpftvsipdeqlddlktlvrlskiapptyeslqadgrfgitsewlt
    tmrekwlsefdwrpfearlnsfpqftteiegltihfaalfseredavpiallhgwpgsfv
    efypilqlfreeytpetlpfhlvvpslpgytfssgppldkdfglmdnarvvdqlmkdlgf
    gsgyiiqggdigsfvgrllgvgfdackavhlnlcamrappegpsieslsaaekegiarme
    kfmtdglayamehstrpstighvlssspiallawigekylqwvdkplpsetilemvslyw
    ltesfpraihtyrettpmlqkelyihkpfgfsffpkdlcpvprswiattgnlvffrdhae
    gghfaalerprelktdltafveqvw