PDB entry 3g0f

View 3g0f on RCSB PDB site
Description: KIT kinase domain mutant D816H in complex with sunitinib
Class: transferase
Keywords: KIT Kinase domain, Sutent binding, drug resistance, ATP-binding, Disease mutation, Glycoprotein, Immunoglobulin domain, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Proto-oncogene, Receptor, Transmembrane, Tyrosine-protein kinase, TRANSFERASE
Deposited on 2009-01-27, released 2009-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.207
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mast/stem cell growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g0fa_
  • Chain 'B':
    Compound: Mast/stem cell growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3g0fb_
  • Heterogens: B49, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g0fA (A:)
    gptykylqkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafg
    kvveataygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgact
    iggptlviteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakg
    maflaskncihrdlaarnillthgritkicdfglarhikndsnyvvkgnarlpvkwmape
    sifncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaem
    ydimktcwdadplkrptfkqivqliekqisestnhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0fA (A:)
    nnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavkml
    kpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrrk
    rdsfldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglarhikn
    dsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpvdskf
    ykmikegfrmlspehapaemydimktcwdadplkrptfkqivqliekqise
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g0fB (B:)
    gptykylqkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafg
    kvveataygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgact
    iggptlviteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakg
    maflaskncihrdlaarnillthgritkicdfglarhikndsnyvvkgnarlpvkwmape
    sifncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaem
    ydimktcwdadplkrptfkqivqliekqisestnhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0fB (B:)
    ngnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvavk
    mlkpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflr
    rkrdsfldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglarhi
    kndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpvds
    kfykmikegfrmlspehapaemydimktcwdadplkrptfkqivqliekqise