PDB entry 3g0e

View 3g0e on RCSB PDB site
Description: KIT kinase domain in complex with sunitinib
Class: transferase
Keywords: KIT Kinase domain, Sutent binding, drug resistance, ATP-binding, Disease mutation, Glycoprotein, Immunoglobulin domain, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Proto-oncogene, Receptor, Transmembrane, Tyrosine-protein kinase, TRANSFERASE
Deposited on 2009-01-27, released 2009-02-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mast/stem cell growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10721 (2-151)
      • expression tag (0-1)
    • Uniprot P10721 (154-End)
      • see remark 999 (152-153)
    Domains in SCOPe 2.06: d3g0ea1, d3g0ea2
  • Heterogens: B49, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g0eA (A:)
    gptykylqkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafg
    kvveataygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgact
    iggptlviteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakg
    maflaskncihrdlaarnillthgritkicdfglardikndsnyvvkgnarlpvkwmape
    sifncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaem
    ydimktcwdadplkrptfkqivqliekqisestnhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g0eA (A:)
    gptykylqkpmyevqwkvveeingnnyvyidptqlpydhkwefprnrlsfgktlgagafg
    kvveataygliksdaamtvavkmlkpsahlterealmselkvlsylgnhmnivnllgact
    iggptlviteyccygdllnflrrkrdsficsktspaimeddelaldledllsfsyqvakg
    maflaskncihrdlaarnillthgritkicdfglardikndsnyvvkgnarlpvkwmape
    sifncvytfesdvwsygiflwelfslgsspypgmpvdskfykmikegfrmlspehapaem
    ydimktcwdadplkrptfkqivqliekqises