PDB entry 3g03

View 3g03 on RCSB PDB site
Description: Structure of human MDM2 in complex with high affinity peptide
Class: cell cycle
Keywords: Mdm2, Hdm2, Mdmx, Hdmx, Mdm4, p53, cancer, apoptosis, cell cycle, Alternative splicing, Cytoplasm, Host-virus interaction, Ligase, Metal-binding, Nucleus, Phosphoprotein, Proto-oncogene, Ubl conjugation, Ubl conjugation pathway, Zinc, Zinc-finger
Deposited on 2009-01-27, released 2009-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g03a_
  • Chain 'B':
    Compound: High affinity synthetic peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3G03 (0-End)
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3g03c_
  • Chain 'D':
    Compound: High affinity synthetic peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3G03 (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3g03A (A:)
mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen

    Sequence, based on observed residues (ATOM records): (download) 
    >3g03A (A:)
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvvvn

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3g03C (C:)
mqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
csndllgdlfgvpsfsvkehrkiytmiyrnlvvvnqqessdsgtsvsen

    Sequence, based on observed residues (ATOM records): (download) 
    >3g03C (C:)
tlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgdl
fgvpsfsvkehrkiytmiyrnlv

  • Chain 'D':
    No sequence available.