PDB entry 3g01

View 3g01 on RCSB PDB site
Description: Structure of GrC mutant E192R/E193G
Class: hydrolase
Keywords: hydrolase, Cytolysis, Protease, Serine protease, Zymogen
Deposited on 2009-01-27, released 2009-03-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Granzyme C
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08882 (0-226)
      • see remark 999 (48)
      • engineered (181)
    Domains in SCOPe 2.01: d3g01a_
  • Chain 'B':
    Compound: Granzyme C
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08882 (0-226)
      • see remark 999 (48)
      • engineered (181)
    Domains in SCOPe 2.01: d3g01b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3g01A (A:)
    iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
    kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
    decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf
    rgdsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g01A (A:)
    iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
    kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
    decyvagwgkvktlhevkltvqkdqvcesqfqssynraneicvgdgdsggplvckraaag
    ivsygqtdgsapqvftrvlsfvswikktmkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3g01B (B:)
    iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
    kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
    decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf
    rgdsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3g01B (B:)
    iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
    kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
    decyvagwgkvktlhevkltvqkdqvcesqfqssynraneicvgdgdsggplvckraaag
    ivsygqgsapqvftrvlsfvswikktmkh