PDB entry 3fzz

View 3fzz on RCSB PDB site
Description: Structure of GrC
Class: hydrolase
Keywords: hydrolase, Cytolysis, Protease, Serine protease, Zymogen
Deposited on 2009-01-27, released 2009-03-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Granzyme C
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08882 (0-226)
      • see remark 999 (48)
    Domains in SCOPe 2.01: d3fzza_
  • Chain 'B':
    Compound: Granzyme C
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08882 (0-226)
      • see remark 999 (48)
    Domains in SCOPe 2.01: d3fzzb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fzzA (A:)
    iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
    kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
    decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf
    eedsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fzzB (B:)
    iiggneisphsrpymayyeflkvggkkmfcggflvrdkfvltaahckgrsmtvtlgahni
    kakeetqqiipvakaiphpdynpddrsndimllklvrnakrtravrplnlprrnahvkpg
    decyvagwgkvtpdgefpktlhevkltvqkdqvcesqfqssynraneicvgdskikgasf
    eedsggplvckraaagivsygqtdgsapqvftrvlsfvswikktmkh