PDB entry 3fzu

View 3fzu on RCSB PDB site
Description: IgG1 Fab characterized by H/D exchange
Class: immune system
Keywords: IgG1 Fab, IMMUNE SYSTEM
Deposited on 2009-01-26, released 2009-03-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: immunoglobulin IgG1 Fab, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FZU (0-End)
  • Chain 'D':
    Compound: immunoglobulin IgG1 Fab, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FZU (0-End)
    Domains in SCOPe 2.04: d3fzud1, d3fzud2
  • Chain 'H':
    Compound: immunoglobulin IgG1 Fab, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FZU (0-End)
  • Chain 'L':
    Compound: immunoglobulin IgG1 Fab, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3FZU (0-End)
    Domains in SCOPe 2.04: d3fzul1, d3fzul2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fzuD (D:)
    diqmtqspsslsasvgdrvtitcrasqdiryylnwyqqkpgkapklliyvasslqsgvps
    rfsgsgsgteftltvsslqpedfatyyclqvystprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fzuD (D:)
    diqmtqspsslsasvgdrvtitcrasqdiryylnwyqqkpgkapklliyvasslqsgvps
    rfsgsgsgteftltvsslqpedfatyyclqvystprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3fzuL (L:)
    diqmtqspsslsasvgdrvtitcrasqdiryylnwyqqkpgkapklliyvasslqsgvps
    rfsgsgsgteftltvsslqpedfatyyclqvystprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fzuL (L:)
    diqmtqspsslsasvgdrvtitcrasqdiryylnwyqqkpgkapklliyvasslqsgvps
    rfsgsgsgteftltvsslqpedfatyyclqvystprtfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge