PDB entry 3fzq

View 3fzq on RCSB PDB site
Description: Crystal structure of putative haloacid dehalogenase-like hydrolase (YP_001086940.1) from Clostridium difficile 630 at 2.10 A resolution
Class: hydrolase
Keywords: YP_001086940.1, putative haloacid dehalogenase-like hydrolase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Hydrolase
Deposited on 2009-01-26, released 2009-02-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydrolase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD0467, YP_001086940.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3fzqa_
  • Chain 'B':
    Compound: Putative hydrolase
    Species: Clostridium difficile [TaxId:272563]
    Gene: CD0467, YP_001086940.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3fzqb_
  • Heterogens: PO4, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fzqA (A:)
    gmklykllildidgtlrdevygipesakhairlcqknhcsvvictgrsmgtiqddvlslg
    vdgyiagggnyiqyhgellynqsfnqrlikevvcllkkrevafsiesqekvfmnqkakei
    fetmnqlkgtnscinkqhiqekityennieeyksqdihkiclwsnekvfdevkdilqdkm
    elaqrdissqyyeiiqkdfhkgkaikrlqerlgvtqketicfgdgqndivmfqasdvtia
    mknshqqlkdiatsicedifdngiykelkrrnii
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fzqA (A:)
    lykllildidgtlrdevygipesakhairlcqknhcsvvictgrsmgtiqddvlslgvdg
    yiagggnyiqyhgellynqsfnqrlikevvcllkkrevafsiesqekvfmnqkakeifet
    mnqlkgtnscinkqhiqekityennieeyksqdihkiclwsnekvfdevkdilqdkmela
    qrdissqyyeiiqkdfhkgkaikrlqerlgvtqketicfgdgqndivmfqasdvtiamkn
    shqqlkdiatsicedifdngiykelkrrnii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fzqB (B:)
    gmklykllildidgtlrdevygipesakhairlcqknhcsvvictgrsmgtiqddvlslg
    vdgyiagggnyiqyhgellynqsfnqrlikevvcllkkrevafsiesqekvfmnqkakei
    fetmnqlkgtnscinkqhiqekityennieeyksqdihkiclwsnekvfdevkdilqdkm
    elaqrdissqyyeiiqkdfhkgkaikrlqerlgvtqketicfgdgqndivmfqasdvtia
    mknshqqlkdiatsicedifdngiykelkrrnii
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fzqB (B:)
    mklykllildidgtlrdevygipesakhairlcqknhcsvvictgrsmgtiqddvlslgv
    dgyiagggnyiqyhgellynqsfnqrlikevvcllkkrevafsiesqekvfmnqkakeif
    etmnqlktyennieeyksqdihkiclwsnekvfdevkdilqdkmelaqrdissqyyeiiq
    kdfhkgkaikrlqerlgvtqketicfgdgqndivmfqasdvtiamknshqqlkdiatsic
    edifdngiykelkrrnii