PDB entry 3fzo

View 3fzo on RCSB PDB site
Description: Crystal Structure of PYK2-Apo, Proline-rich Tyrosine Kinase
Class: transferase
Keywords: tyrosine kinase, dfg-out, Alternative splicing, ATP-binding, Cell membrane, Cytoplasm, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Polymorphism, Transferase, Tyrosine-protein kinase
Deposited on 2009-01-26, released 2009-03-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.207
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine kinase 2 beta
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3fzoa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fzoA (A:)
    pqygiaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmsea
    vimknldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqick
    amaylesincvhrdiavrnilvaspecvklgdfglsryiededyykasvtrlpikwmspe
    sinfrrfttasdvwmfavcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvly
    tlmtrcwdydpsdrprftelvcslsdvyqmekdiame
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fzoA (A:)
    iaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmseavimk
    nldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqickamay
    lesincvhrdiavrnilvaspecvklgdfglsryiedlpikwmspesinfrrfttasdvw
    mfavcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvlytlmtrcwdydpsdr
    prftelvcslsdvyqmekdiam