PDB entry 3fz6

View 3fz6 on RCSB PDB site
Description: Crystal structure of glutamate decarboxylase beta from Escherichia coli: complex with xenon
Class: lyase
Keywords: Glutamate decarboxylase, pmp form, xenon, Decarboxylase, Lyase, Membrane, Pyridoxal phosphate
Deposited on 2009-01-23, released 2009-02-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: 0.138
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b1493, gadB, JW1488
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fz6a_
  • Chain 'B':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b1493, gadB, JW1488
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fz6b_
  • Chain 'C':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b1493, gadB, JW1488
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fz6c_
  • Chain 'D':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b1493, gadB, JW1488
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fz6d_
  • Chain 'E':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b1493, gadB, JW1488
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fz6e_
  • Chain 'F':
    Compound: Glutamate decarboxylase beta
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b1493, gadB, JW1488
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fz6f_
  • Heterogens: PMP, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fz6A (A:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fz6A (A:)
    elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
    vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
    lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
    krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
    pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
    tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
    degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
    dfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fz6B (B:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fz6B (B:)
    kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
    cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
    igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
    pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
    aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
    dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
    efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
    mcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fz6C (C:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fz6C (C:)
    elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
    vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
    lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
    krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
    pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
    tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
    degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
    dfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fz6D (D:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fz6D (D:)
    elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
    vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
    lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
    krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
    pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
    tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
    degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
    dfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fz6E (E:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fz6E (E:)
    kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
    fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
    tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
    rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
    daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
    vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
    yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
    imcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fz6F (F:)
    mdkkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnl
    atfcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavg
    tntigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelrei
    pmrpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididm
    hidaasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelv
    fnvdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiakl
    gpyefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivv
    mrimcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fz6F (F:)
    elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
    vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
    lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
    krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
    pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
    tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
    degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
    dfaellledykaslkylsdhpklqgiaqqnsfkht