PDB entry 3fz4

View 3fz4 on RCSB PDB site
Description: The crystal structure of a possible arsenate reductase from Streptococcus mutans UA159
Class: oxidoreductase
Keywords: APC61768, arsenate reductase, Streptococcus mutans UA159, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, OXIDOREDUCTASE
Deposited on 2009-01-23, released 2009-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-10, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.169
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative arsenate reductase
  Species: Streptococcus mutans UA159 [TaxId:210007]
  Gene: SMU_1651
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8DSV8 (3-119)
    • expression tag (1-2)
    • engineered (103)
  Domains in SCOPe 2.08: d3fz4a1, d3fz4a2
• Heterogens: NA, EDO, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3fz4A (A:)
  snamltfyeypkcstcrrakaelddlawdydaidikknppaaslirnwlensglelkkff
  ntsgqsyralglkdklhqlsldeaanllasdgmlikrpllvkegkivqigyrtayedldf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3fz4A (A:)
  namltfyeypkcstcrrakaelddlawdydaidikknppaaslirnwlensglelkkffn
  tsgqsyralglkdklhqlsldeaanllasdgmlikrpllvkegkivqigyrtayedldf