PDB entry 3fyw

View 3fyw on RCSB PDB site
Description: Staph. aureus DHFR complexed with NADPH and AR-101
Class: oxidoreductase
Keywords: Staph. aureus DHFR, AR-101, OXIDOREDUCTASE, NADP, One-carbon metabolism
Deposited on 2009-01-23, released 2009-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3fywx_
  • Heterogens: NDP, XCF, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fywX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirkk