PDB entry 3fyv

View 3fyv on RCSB PDB site
Description: Staph. aureus DHFR complexed with NADPH and AR-102
Class: oxidoreductase
Keywords: DHFR, Staph.aureus, AR-102, OXIDOREDUCTASE, NADP, One-carbon metabolism
Deposited on 2009-01-23, released 2009-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fyvx_
  • Heterogens: NDP, XCF, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fyvX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirkk