PDB entry 3fyt

View 3fyt on RCSB PDB site
Description: Crystal structure of Bacillus pumilus acetyl xylan esterase S181A mutant in complex with beta-D-xylopyranose
Class: hydrolase
Keywords: alpha/beta hydrolase, carbohydrate esterase, CE7, Bacillus pumilus, Hydrolase
Deposited on 2009-01-23, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fyta_
  • Chain 'B':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytb_
  • Chain 'C':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytc_
  • Chain 'D':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytd_
  • Chain 'E':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fyte_
  • Chain 'F':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytf_
  • Chain 'G':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytg_
  • Chain 'H':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fyth_
  • Chain 'I':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fyti_
  • Chain 'L':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytl_
  • Chain 'M':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytm_
  • Chain 'N':
    Compound: acetyl xylan esterase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: axe
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K5F2
      • engineered (180)
    Domains in SCOPe 2.07: d3fytn_
  • Heterogens: CL, XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fytA (A:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytA (A:)
    fdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqs
    fghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggs
    edtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqg
    galaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafe
    tlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipa
    fqteklsflqkhlll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fytB (B:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytB (B:)
    fdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqs
    fghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggs
    edtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqg
    galaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafe
    tlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipa
    fqteklsflqkhll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fytC (C:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytC (C:)
    lsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqsfg
    hskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggsed
    tsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqgga
    laiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafetl
    syfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipafq
    teklsflqkhll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3fytD (D:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytD (D:)
    lfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyq
    sfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqgg
    sedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaq
    ggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekaf
    etlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefip
    afqteklsflqkhll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3fytE (E:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytE (E:)
    fdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqs
    fghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggs
    edtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqg
    galaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafe
    tlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipa
    fqteklsflqkhll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3fytF (F:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytF (F:)
    sleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqsfgh
    skiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggsedt
    svtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqggal
    aiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafetls
    yfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipafqt
    eklsflqkhll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3fytG (G:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytG (G:)
    lsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqsfg
    hskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggsed
    tsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqgga
    laiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafetl
    syfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipafq
    teklsflqkhll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3fytH (H:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytH (H:)
    fdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqs
    fghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggs
    edtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqg
    galaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafe
    tlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipa
    fqteklsflqkhlll
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3fytI (I:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytI (I:)
    dlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqsf
    ghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggse
    dtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqgg
    alaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafet
    lsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipaf
    qteklsflqkhll
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3fytL (L:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytL (L:)
    fdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqs
    fghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggs
    edtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqg
    galaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafe
    tlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipa
    fqteklsflqkhllls
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3fytM (M:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytM (M:)
    sleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqsfgh
    skiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggsedt
    svtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqggal
    aiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafetls
    yfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipafqt
    eklsflqkhll
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3fytN (N:)
    mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
    yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
    ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
    aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
    afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
    ipafqteklsflqkhlllst
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fytN (N:)
    dlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrltyqsf
    ghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqggse
    dtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggaqgg
    alaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveekafet
    lsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefipaf
    qteklsflqkhll