SCOPe 2.07: Structural Classification of Proteins

PDB entry 3fyt

View 3fyt on RCSB PDB site
Description: Crystal structure of Bacillus pumilus acetyl xylan esterase S181A mutant in complex with beta-D-xylopyranose
Class: hydrolase
Keywords: alpha/beta hydrolase, carbohydrate esterase, CE7, Bacillus pumilus, Hydrolase
Deposited on 2009-01-23, released 2010-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fyta_
Chain 'B':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytb_
Chain 'C':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytc_
Chain 'D':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytd_
Chain 'E':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fyte_
Chain 'F':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytf_
Chain 'G':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytg_
Chain 'H':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fyth_
Chain 'I':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fyti_
Chain 'L':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytl_
Chain 'M':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytm_
Chain 'N':
Compound: acetyl xylan esterase
Species: Bacillus pumilus [TaxId:1408]
Gene: axe
Database cross-references and differences (RAF-indexed):
- Uniprot Q9K5F2
  - engineered (180)
Domains in SCOPe 2.07: d3fytn_
Heterogens: CL, XYP, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3fytA (A:)
mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
aqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
ipafqteklsflqkhlllst