PDB entry 3fyr

View 3fyr on RCSB PDB site
Description: Crystal structure of the sporulation histidine kinase inhibitor Sda from Bacillus subtilis
Class: Transferase inhibitor
Keywords: helical hairpin, histidine kinase inhibitor, sporulation regulation, Alternative initiation, Protein kinase inhibitor, Sporulation, Transferase inhibitor
Deposited on 2009-01-23, released 2009-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sporulation inhibitor sda
    Species: Bacillus subtilis [TaxId:224308]
    Gene: BSU25690, sda
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fyra_
  • Chain 'B':
    Compound: Sporulation inhibitor sda
    Species: Bacillus subtilis [TaxId:224308]
    Gene: BSU25690, sda
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fyrb_
  • Chain 'C':
    Compound: Sporulation inhibitor sda
    Species: Bacillus subtilis [TaxId:224308]
    Gene: BSU25690, sda
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3fyrc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fyrA (A:)
    gsmrklsdelliesyfkatemnlnrdfielieneikrrslghiisvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyrA (A:)
    mrklsdelliesyfkatemnlnrdfielieneikrrsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fyrB (B:)
    gsmrklsdelliesyfkatemnlnrdfielieneikrrslghiisvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyrB (B:)
    mrklsdelliesyfkatemnlnrdfielieneikrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3fyrC (C:)
    gsmrklsdelliesyfkatemnlnrdfielieneikrrslghiisvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyrC (C:)
    klsdelliesyfkatemnlnrdfielieneikrrslghi