PDB entry 3fyn

View 3fyn on RCSB PDB site
Description: crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3
Deposited on 2009-01-22, released 2009-02-10
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integron gene cassette protein HFX_CASS3
    Species: Uncultured bacterium [TaxId:77133]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0BFQ1 (22-End)
      • expression tag (15-21)
  • Heterogens: MG, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3fynA (A:)
mgsshhhhhhssgrenlyfqglspqvrtahigdvpvlvrlmsefyqeagfalphdaaira
fkallgkpdlgriwliaegtesvgyivltlgfsmeygglrgfvddffvrpnargkglgaa
alqtvkqgccdlgvrallvetgpedhpargvysragfeesgrmllgqalappihea

    Sequence, based on observed residues (ATOM records):
    >3fynA (A:)
nlyfqglspqvrtahigdvpvlvrlmsefyqeagfalphdaairafkallgkpdlgriwl
iaegtesvgyivltlgfsmeygglrgfvddffvrpnargkglgaaalqtvkqgccdlgvr
allvetgvysragfeesgrmllgqalappihe