PDB entry 3fyh

View 3fyh on RCSB PDB site
Description: Recombinase in complex with ADP and metatungstate
Class: recombination
Keywords: ATPase, RadA, Rad51, RecA, recombinase, inhibitor, RadA-inhibitor complex, ATP-binding, DNA damage, DNA recombination, DNA-binding, Nucleotide-binding, RECOMBINATION
Deposited on 2009-01-22, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fyha1, d3fyha2
  • Heterogens: ADP, MG, NA, W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fyhA (A:)
    mgdnltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlc
    dlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscv
    nlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfva
    raynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrhmat
    lnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrvakl
    ydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fyhA (A:)
    ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf
    ksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhqscvnlqn
    peflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldntfvarayn
    sdmqmlfaekiedliqegnniklvvidsltstfrneytklaerqqklgrhmatlnkladl
    fncvvlvtnqvsghaatfrffvrkgkgdkrvaklydsphlpdaeaifritekgiqd